[KD Validated] PHF11 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23994
Zusätzliche Namen:: [KD Validated] PHF11|APY|BCAP|IGEL|IGER|IGHER|NY-REN-34|NYREN34
Anwendung:: ELISA, WB
Molekulargewicht:: 34 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMS
Uniprot:: Q9UIL8
Synonyme:: APY;BCAP;BRCA1 C-terminus-associated protein;IgE responsiveness (atopic);IGEL;IGER;IGHER;NY-REN-34;NYREN34;PHD finger protein 11;renal carcinoma antigen NY-REN-34
Weitere Details:: This gene encodes a protein containing a PHD (plant homeodomain) type zinc finger. This gene has been identified in some studies as a candidate gene for asthma. Naturally-occurring readthrough transcription may occur from the upstream SETDB2 (SET domain bifurcated 2) gene to this locus. Alternative splicing results in multiple transcript variants.