Peroxiredoxin 3 (PRDX3) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2398
Zusätzliche Namen:: AOP-1|AOP1|HBC189|MER5|Peroxiredoxin 3 (PRDX3)|PPPCD|PRO1748|prx-III|SCAR32|SP-22
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
Uniprot:: P30048
Synonyme:: antioxidant protein 1;AOP-1;AOP1;epididymis secretory sperm binding protein;HBC189;MER5;peroxiredoxin III;Peroxiredoxin-3;PRO1748;protein MER5 homolog;prx-III;SP-22;thioredoxin-dependent peroxide reductase, mitochondrial;thioredoxin-dependent peroxiredoxin 3
Weitere Details:: This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22.

Versandbedingungen:: Blue Ice