RAB5A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23955
Zusätzliche Namen:: RAB5|RAB5A|ras-related protein Rab-5A
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 24kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Uniprot:: P20339
Synonyme:: RAB5;RAS-associated protein RAB5A;ras-related protein Rab-5A
Weitere Details:: RAB5A (RAB5A, member RAS oncogene family) is a protein-coding gene. Diseases associated with RAB5A include borna disease, and venezuelan equine encephalitis. GO annotations related to this gene include GDP binding and GTP binding. An important paralog of this gene is RAB20.