A23938
C3c Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A23938
- Zusätzliche Namen:
- AHUS5|ARMD9|ASP|C3a|C3b|C3c|CPAMD1|HEL-S-62p
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 187kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
- Uniprot:
- P01024
- Synonyme:
- acylation-stimulating protein cleavage product;AHUS5;ARMD9;ASP;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1;C3a;C3a anaphylatoxin;C3b;complement C3;complement component 3;complement component C3a;complement component C3b;CPAMD1;epididymis secretory sperm binding protein Li 62p;HEL-S-62p;prepro-C3
- Weitere Details:
- Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients.
- Versandbedingungen:
- Blue Ice



_IF_01.jpg)