ABflo[R] 647 Rabbit anti-Mouse CD83 monoclonal antibody

Größe

Auf Anfrage

SKU:: A23907
Zusätzliche Namen:: mCD83
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR
Uniprot:: O88324
Synonyme:: B-cell activation protein;BL11;CD83 antigen;CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);cell surface protein HB15;cell-surface glycoprotein;HB15;hCD83;mCD83
Weitere Details:: Acts upstream of or within positive regulation of CD4-positive, alpha-beta T cell differentiation; regulation of cytokine production; and response to organic cyclic compound. Located in external side of plasma membrane. Is expressed in alimentary system; genitourinary system; hemolymphoid system gland; and nervous system. Orthologous to human CD83 (CD83 molecule).