COL10A1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A23884
Zusätzliche Namen:: COL10A1|collagen alpha-1(X) chain
Anwendung:: ELISA, WB
Molekulargewicht:: 66kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPP
Uniprot:: Q03692
Synonyme:: collagen alpha-1(X) chain;collagen X, alpha-1 polypeptide;collagen, type X, alpha 1;Schmid metaphyseal chondrodysplasia
Weitere Details:: This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).