A23860
OMA1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23860
- Zusätzliche Namen:
- 2010001O09Rik|DAB1|MPRP-1|MPRP1|OMA1|peptidase|YKR087C|ZMPOMA1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEK
- Uniprot:
- Q96E52
- Synonyme:
- 2010001O09Rik;DAB1;metalloendopeptidase OMA1, mitochondrial;metalloprotease-related protein 1;MPRP-1;MPRP1;OMA1 homolog, zinc metallopeptidase;OMA1 zinc metallopeptidase homolog;overlapping activity with M-AAA protease;overlapping with the m-AAA protease 1 homolog;peptidase;YKR087C;zinc metallopeptidase OMA1;ZMPOMA1
- Weitere Details:
- Enables metalloendopeptidase activity. Involved in several processes, including HRI-mediated signaling; proteolysis; and regulation of mitochondrion organization. Located in mitochondrial inner membrane.
- Versandbedingungen:
- Blue Ice