A23832
SDHB Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23832
- Zusätzliche Namen:
- CWS2|IP|PGL4|SDH|SDH1|SDH2|SDHB|SDHIP|succinate dehydrogenase complex iron sulfur subunit B
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
- Uniprot:
- P21912
- Synonyme:
- CWS2;IP;iron-sulfur subunit of complex II;MC2DN4;PGL4;SDH;SDH1;SDH2;SDHIP;succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial;succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
- Weitere Details:
- Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
- Versandbedingungen:
- Blue Ice