ABflo[R] 488 Rabbit anti-Mouse CD278/ICOS monoclonal antibody

Größe

Auf Anfrage

SKU:: A23813
Zusätzliche Namen:: AILIM|CCLP|CRP-1|H4|Ly115
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
Uniprot:: Q9WVS0
Synonyme:: activation-inducible lymphocyte immunomediatory molecule;AILIM;CCLP;CD278;CD28 and CTLA-4-like protein;CD28-related protein 1;CRP-1;CVID1;H4;inducible costimulator;inducible T-cell co-stimulator;inducible T-cell costimulator;Ly115
Weitere Details:: Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).