ABflo[R] 488 Rabbit anti-Mouse CD25 monoclonal antibody

Größe

Auf Anfrage

SKU:: A23807
Zusätzliche Namen:: CD25|Il2r|Ly-43
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Uniprot:: P01590
Synonyme:: CD25;I;IDDM10;IL-2 receptor subunit alpha;IL-2-RA;IL-2R alpha chain;IL-2R subunit alpha;IL2-RA;IL2R;IMD41;interleukin 2 receptor, alpha;interleukin-2 receptor subunit alpha;Ly-4;Ly-43;p55;p55 chain;TAC antigen;TCGFR
Weitere Details:: Enables interleukin-2 binding activity and interleukin-2 receptor activity. Acts upstream of or within several processes, including Notch signaling pathway; activation-induced cell death of T cells; and regulation of T cell proliferation. Located in external side of plasma membrane. Is expressed in bone marrow. Used to study Sjogren's syndrome and inflammatory bowel disease. Human ortholog(s) of this gene implicated in immunodeficiency 41; lymphopenia; multiple sclerosis; type 1 diabetes mellitus; and type 1 diabetes mellitus 10. Orthologous to human IL2RA (interleukin 2 receptor subunit alpha).

Versandbedingungen:: Blue Ice