A23783
CD244 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23783
- Zusätzliche Namen:
- 2B4|CD244|CD244 molecule|NAIL|NKR2B4|Nmrk|SLAMF4
- Anwendung:
- ELISA, Flow Cytometry, WB
- Molekulargewicht:
- 70-120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA
- Uniprot:
- Q9BZW8
- Synonyme:
- 2B4;CD244 molecule, natural killer cell receptor 2B4;h2B4;NAIL;natural killer cell receptor 2B4;NK cell activation inducing ligand NAIL;NK cell activation-inducing ligand;NK cell type I receptor protein 2B4;NKR2B4;Nmrk;signaling lymphocytic activation molecule 4;SLAM family member 4;SLAMF4
- Weitere Details:
- This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice





