EGFR Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23764
Zusätzliche Namen:: EGFR|epidermal growth factor receptor|ERBB|ERBB1|HER1|mENA|NISBD2|PIG61
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 175 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
Uniprot:: P00533
Synonyme:: avian erythroblastic leukemia viral (v-erb-b) oncogene homolog;cell growth inhibiting protein 40;cell proliferation-inducing protein 61;epidermal growth factor receptor;epidermal growth factor receptor tyrosine kinase domain;erb-b2 receptor tyrosine kinase 1;ERBB;ERBB1;ERRP;HER1;mENA;NISBD2;PIG61;proto-oncogene c-ErbB-1;receptor tyrosine-protein kinase erbB-1
Weitere Details:: The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer.

Versandbedingungen:: Blue Ice