A23693
TLE4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23693
- Zusätzliche Namen:
- BCE-1|BCE1|E(spI)|E(spl)|ESG|ESG4|Grg-4|GRG4|TLE4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 84kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHL
- Uniprot:
- Q04727
- Synonyme:
- B lymphocyte gene 1;BCE-1;BCE1;E(spI);E(spl);enhancer of split groucho 4;ESG;ESG4;Grg-4;GRG4;groucho-related protein 4;transducin like enhancer of split 4;transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila);transducin-like enhancer of split 4, homolog of Drosophila E(sp1);transducin-like enhancer protein 4
- Weitere Details:
- Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway; cellular response to leukemia inhibitory factor; and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.
- Versandbedingungen:
- Blue Ice

