A23685
Sestrin 2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23685
- Zusätzliche Namen:
- HI95|SES2|SEST2|Sestrin 2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCV
- Uniprot:
- P58004
- Synonyme:
- HI95;hypoxia induced gene 95;hypoxia-induced;Hypoxia-induced gene;SES2;SEST2;sestrin-2
- Weitere Details:
- This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions.
- Versandbedingungen:
- Blue Ice