A23681
[KD Validated] COX7A2L Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A23681
- Zusätzliche Namen:
- [KD Validated] COX7A2L|COX7AR|COX7RP|EB1|SCAF1|SCAFI|SIG81
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
- Uniprot:
- O14548
- Synonyme:
- COX7a-related protein;COX7AR;COX7RP;cytochrome c oxidase subunit 7A-related protein, mitochondrial;cytochrome c oxidase subunit VII-related protein;cytochrome c oxidase subunit VIIa polypeptide 2 like;cytochrome c oxidase subunit VIIa-related protein;EB1;estrogen receptor binding CpG island;SCAF1;SCAFI;SIG81
- Weitere Details:
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KD Validated] COX7A2L Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23681/A23681_1.jpg)
![[KD Validated] COX7A2L Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23681/A23681_N25896-4_WB_01.jpg)