CCT6A Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A23676
Zusätzliche Namen:: CCT-zeta|CCT-zeta-1|CCT6|Cctz|HTR3|MoDP-2|TCP-1-zeta|TCP20|TCPZ|TTCP20
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa/58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFY
Uniprot:: P40227
Synonyme:: acute morphine dependence related protein 2;Acute morphine dependence-related protein 2;amino acid transport defect-complementing;CCT-zeta;CCT-zeta-1;CCT6;Cctz;chaperonin containing T-complex subunit 6;chaperonin containing TCP1, subunit 6A (zeta 1);histidine transport regulator 3;HTR3;MoDP-2;T-complex protein 1 subunit zeta;T-complex protein 1, zeta subunit;TCP-1-zeta;TCP20;TCPZ;TTCP20
Weitere Details:: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located.

Versandbedingungen:: Blue Ice