A23665
IL22 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23665
- Zusätzliche Namen:
- If2b1|IL-22|IL-22a|IL22|Iltif|ILTIFa
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 16kDa/18kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Uniprot:
- Q9JJY9
- Synonyme:
- If2b1;Il;IL-;IL-10-related T-cell-derived-inducible factor;IL-22;IL-22a;IL-TIF alpha;Iltif;ILTIF alpha;ILTIFa;interferon 2b1;interleukin 10-related T cell-derived inducible factor;interleukin-22;interleukin-22a
- Weitere Details:
- Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
- Versandbedingungen:
- Blue Ice