A23664
Chek2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A23664
- Zusätzliche Namen:
- Cds1|Chek2|CHK2|HUCDS1|Rad53
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62-68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNLDCVNDNYWFGRDKSCEYCFDGPLLRRTDKYRTYSKKHFRIFREMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSV
- Uniprot:
- Q9Z265
- Synonyme:
- Cds1;Cds1 homolog;Checkpoint kinase 2;CHK2;CHK2 checkpoint homolog;HUCDS1;Rad;Rad53;Rad53 homolog;serine/threonine-protein kinase Chk2
- Weitere Details:
- Enables protein kinase activity. Acts upstream of or within cellular response to gamma radiation; peptidyl-serine phosphorylation; and signal transduction by p53 class mediator. Predicted to be located in Golgi apparatus and PML body. Predicted to be active in cytoplasm and nucleus. Predicted to colocalize with chromosome, telomeric region. Is expressed in several structures, including central nervous system; genitourinary system; and liver. Human ortholog(s) of this gene implicated in several diseases, including Li-Fraumeni syndrome 2; breast cancer (multiple); colorectal cancer; osteosarcoma; and prostate cancer. Orthologous to human CHEK2 (checkpoint kinase 2).
- Versandbedingungen:
- Blue Ice

