CD97 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23662
Zusätzliche Namen:: Cd97|TM7LN1
Anwendung:: ELISA, WB
Molekulargewicht:: 90kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQASVNTGMTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTPKDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPF
Uniprot:: Q9Z0M6
Synonyme:: AA409984;adhesion G protein-coupled receptor E5;CD97;CD97 antigen;CD97 molecule;EGF-TM7 receptor;leukocyte antigen CD97;seven transmembrane helix receptor;seven-span transmembrane protein;seven-transmembrane, heterodimeric receptor associated with inflammation;TM7LN1
Weitere Details:: Predicted to enable G protein-coupled receptor activity and chondroitin sulfate binding activity. Acts upstream of or within positive regulation of synapse assembly. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; eye; genitourinary system; gut; and immune system. Human ortholog(s) of this gene implicated in vibratory urticaria. Orthologous to several human genes including ADGRE5 (adhesion G protein-coupled receptor E5).

Versandbedingungen:: Blue Ice