A23659
CD90.1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23659
- Zusätzliche Namen:
- CD90|CD90.1|T25|Thy-1|Thy-1.2|Thy1.1|Thy1.2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18-22kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKS
- Uniprot:
- P01831
- Synonyme:
- CD90;CDw90;T25;Thy-1;thy-1 antigen;thy-1 membrane glycoprotein;Thy-1 T-cell antigen;Thy-1.2;Thy1.1;Thy1.2
- Weitere Details:
- This gene encodes a glycoprotein that is anchored to the cell surface of thymocytes, neuronal and other cells through a glycosyl-phosphatidylinositol moiety. A soluble form of the encoded protein has also been detected in serum and cerebrospinal fluid. The encoded protein undergoes further processing to generate the mature protein which mediates cell-cell interactions to trigger downstream signaling pathways.
- Versandbedingungen:
- Blue Ice