MAPT Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23656
Zusätzliche Namen:: MAPT|Mtapt|PHF-tau|Tau
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 50-80 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLD
Uniprot:: P10637
Synonyme:: AI413597;AW045860;DDPAC;FTDP-17;G protein beta1/gamma2 subunit-interacting factor 1;MAPTL;microtubule-associated protein tau;MSTD;Mta;Mtapt;MTBT1;MTBT2;neurofibrillary tangle protein;paired helical filament-tau;PHF-tau;PPND;PPP1R103;protein phosphatase 1, regulatory subunit 103;Ta;TAU;tau-40
Weitere Details:: Enables DNA binding activity; microtubule binding activity; and protein kinase binding activity. Involved in negative regulation of tubulin deacetylation; regulation of cellular response to heat; and regulation of response to DNA damage stimulus. Acts upstream of or within several processes, including adult walking behavior; generation of neurons; and transport along microtubule. Located in several cellular components, including cytoskeleton; glial cell projection; and postsynaptic density. Is expressed in several structures, including gut; nervous system; sensory organ; smooth muscle tissue; and urinary system. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in dementia (multiple); neurodegenerative disease (multiple); progressive supranuclear palsy; and temporal lobe epilepsy. Orthologous to human MAPT (microtubule associated protein tau).

Versandbedingungen:: Blue Ice