Epcam Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23654
Zusätzliche Namen:: CD326|EGP|EGP-2|Egp314|Ep-CAM|Epcam|EpCAM1|GA733-2|gp40|Ly74|Tacsd1|Tacstd1|TROP1
Anwendung:: ELISA, WB
Molekulargewicht:: 35-40kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Uniprot:: Q99JW5
Synonyme:: CD326;EGP;EGP-;EGP-2;Egp31;Egp314;Ep-C;Ep-CAM;EpC;EpCA;EpCAM1;epithelial cell adhesion molecule;epithelial glycoprotein 314;GA733-;GA733-2;gp4;gp40;Ly7;Ly74;lymphocyte antigen 74;mEGP314;panepithelial glycoprotein 314;protein 289A;Tacsd1;Tacst;Tacstd1;TR;Trop-1 protein;TROP1;tumor-associated calcium signal transducer 1
Weitere Details:: Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).

Versandbedingungen:: Blue Ice