A23641
Human IgG3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23641
- Zusätzliche Namen:
- Human IgG3|IgG3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 68kDa/55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDT
- Uniprot:
- P01860
- Synonyme:
- C gamma 3;constant region of heavy chain of IgG3;HDC;Heavy chain disease protein;Ig gamma-3 chain C region;IgG3;immunoglobulin gamma 3 (Gm marker);immunoglobulin heavy constant gamma 3 (Gm marker);secrete-type Ig gamma heavy-chain
- Weitere Details:
- Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
- Versandbedingungen:
- Blue Ice