Ube1L / UBA7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23575
Zusätzliche Namen:: D8|UBA1B|UBE1L|Ube1L / UBA7|UBE2|UBE7
Anwendung:: ELISA, WB
Molekulargewicht:: 110-118kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNR
Uniprot:: P41226
Synonyme:: D8;UBA1, ubiquitin-activating enzyme E1 homolog B;UBA1B;UBA7, ubiquitin-activating enzyme E1;UBE1L;UBE2;ubiquitin-activating enzyme 7;ubiquitin-activating enzyme E1 homolog;ubiquitin-activating enzyme E1-related protein;ubiquitin-activating enzyme-2;ubiquitin-like modifier-activating enzyme 7
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme is a retinoid target that triggers promyelocytic leukemia (PML)/retinoic acid receptor alpha (RARalpha) degradation and apoptosis in acute promyelocytic leukemia, where it is involved in the conjugation of the ubiquitin-like interferon-stimulated gene 15 protein.

Versandbedingungen:: Blue Ice