CBR1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23568
Zusätzliche Namen:: CBR|CBR1|hCBR1|PG-9-KR|SDR21C1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIG
Uniprot:: P16152
Synonyme:: 15-hydroxyprostaglandin dehydrogenase;15-hydroxyprostaglandin dehydrogenase [NADP(+)];20-beta-hydroxysteroid dehydrogenase;carbonyl reductase (NADPH) 1;carbonyl reductase [NADPH] 1;CBR;epididymis secretory sperm binding protein;hCBR1;NADPH-dependent carbonyl reductase 1;PG-9-KR;prostaglandin 9-ketoreductase;prostaglandin-E(2) 9-reductase;SDR21C1;short chain dehydrogenase/reductase family 21C member 1
Weitere Details:: The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene.