Palladin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23566
Zusätzliche Namen:: CGI-151|CGI151|MYN|Palladin|PNCA1|SIH002
Anwendung:: ELISA, WB
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRST
Uniprot:: Q8WX93
Synonyme:: CGI-151;CGI151;MYN;myoneurin;palladin;PNCA1;sarcoma antigen NY-SAR-77;SIH002
Weitere Details:: This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in this gene are associated with a susceptibility to pancreatic cancer type 1, and also with a risk for myocardial infarction. Alternative splicing results in multiple transcript variants.