RAB22A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23564
Zusätzliche Namen:: RAB22A|ras-related protein Rab-22A
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 22 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWV
Uniprot:: Q9UL26
Synonyme:: GTP-binding protein RAB22A;rab-22;ras-related protein Rab-22A
Weitere Details:: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments.