A23562
EXOC2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23562
- Zusätzliche Namen:
- EXOC2|NEDFACH|SEC5|SEC5L1|Sec5p
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 104 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGI
- Uniprot:
- Q96KP1
- Synonyme:
- exocyst complex component 2;exocyst complex component Sec5;NEDFACH;SEC5;SEC5-like 1;SEC5L1;Sec5p
- Weitere Details:
- The protein encoded by this gene is a component of the exocyst complex, a multi-protein complex essential for the polarized targeting of exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. This protein has been shown to interact with the Ral subfamily of GTPases and thereby mediate exocytosis by tethering vesicles to the plasma membrane. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

