A23551
WNK3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23551
- Zusätzliche Namen:
- PRKWNK3|WNK3
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 170 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TSTWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMPHVCQYNAVAGAGYPVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK
- Uniprot:
- Q9BYP7
- Synonyme:
- PRKWNK3;Protein kinase lysine-deficient 3;protein kinase with no lysine 3;serine/threonine-protein kinase WNK3
- Weitere Details:
- This gene encodes a protein belonging to the 'with no lysine' family of serine-threonine protein kinases. These family members lack the catalytic lysine in subdomain II, and instead have a conserved lysine in subdomain I. This family member functions as a positive regulator of the transcellular Ca2+ transport pathway, and it plays a role in the increase of cell survival in a caspase-3-dependent pathway. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice