A23541
CD16 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23541
- Zusätzliche Namen:
- CD16|CD16-II|CD16A|FCG3|FCGR3|FCGRIII|FcGRIIIA|FCR-10|FCRIII|FCRIIIA|IGFR3|IMD20
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 40-60 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
- Uniprot:
- O75015, P08637
- Synonyme:
- CD16;CD16A;CD16a antigen;CD16b;Fc fragment of IgG, low affinity III, receptor for (CD16);Fc fragment of IgG, low affinity IIIa, receptor (CD16a);Fc fragment of IgG, low affinity IIIb, receptor (CD16b);Fc gamma receptor III-A;Fc gamma receptor III-B;Fc gamma receptor IIIb;Fc-gamma receptor III-2 (CD 16);Fc-gamma receptor IIIb (CD 16);Fc-gamma receptor IIIb (CD16);Fc-gamma RIII-alpha;fc-gamma RIII-beta;fc-gamma RIIIb;FCG3;FcgammaRIIIA;FCGR3;FCGR3A;FCGRIII;FCR-10;FCRIII;FCRIIIA;FCRIIIb;IGFR3;igG Fc receptor III-1;igG Fc receptor III-2;IMD20;immunoglobulin G Fc receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma Fc region receptor III-B;low affinity immunoglobulin gamma receptor III-a Fc fragment;neutrophil-specific antigen NA
- Weitere Details:
- This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice








