CHD4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23537
Zusätzliche Namen:: CHD-4|CHD4|Mi-2b|Mi2-BETA|SIHIWES
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 260kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNI
Uniprot:: Q14839
Synonyme:: ATP-dependent helicase CHD4;CHD-4;chromodomain-helicase-DNA-binding protein 4;Mi-2 autoantigen 218 kDa protein;Mi-2b;Mi2-BETA;SIHIWES
Weitere Details:: The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.