A23536
[KD Validated] DEC1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23536
- Zusätzliche Namen:
- BHLHB2|Clast5|DEC1|HLHB2|SHARP-2|SHARP2|STRA13|Stra14
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 46 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
- Uniprot:
- O14503
- Synonyme:
- basic helix-loop-helix domain containing, class B, 2;BHLHB2;class B basic helix-loop-helix protein 2;class E basic helix-loop-helix protein 40;Clast5;DEC1;differentially expressed in chondrocytes 1;differentially expressed in chondrocytes protein 1;differentiated embryo chondrocyte expressed gene 1;enhancer-of-split and hairy-related protein 2;HLHB2;SHARP-2;SHARP2;stimulated by retinoic acid gene 13 protein;STRA13;Stra14
- Weitere Details:
- This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation.
- Versandbedingungen:
- Blue Ice
![[KD Validated] DEC1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23536/A23536_1.jpg)
![[KD Validated] DEC1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23536/A23536_ARC59676-01_WB_01.jpg)
![[KD Validated] DEC1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23536/A23536_ARC59676-01_WB_02.jpg)
![[KD Validated] DEC1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23536/A23536_ARC59676-01_IHC_01.jpg)
![[KD Validated] DEC1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23536/A23536_ARC59676-01_IHC_02.jpg)