CD2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23527
Zusätzliche Namen:: CD2|LFA-2|Ly-37|Ly37
Anwendung:: ELISA, Flow Cytometry, WB
Molekulargewicht:: 45-65kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS
Uniprot:: P08920
Synonyme:: CD2 antigen (p50), sheep red blood cell receptor;erythrocyte receptor;LFA;LFA-2;LFA-3 receptor;Ly-3;Ly-37;Ly3;Ly37;lymphocyte antigen 37;lymphocyte-function antigen-2;rosette receptor;SRBC;T-cell surface antigen CD2;T-cell surface antigen T11/Leu-5;T11
Weitere Details:: Enables identical protein binding activity. Predicted to be involved in T cell activation; heterotypic cell-cell adhesion; and positive regulation of cytokine production. Located in several cellular components, including cell-cell junction; cytoplasmic side of plasma membrane; and external side of plasma membrane. Is anchored component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD2 (CD2 molecule).

Versandbedingungen:: Blue Ice