Bak Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23523
Zusätzliche Namen:: BAK|BAK-LIKE|BCL2L7|CDN1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIG
Uniprot:: Q16611
Synonyme:: apoptosis regulator BAK;BAK;BAK-LIKE;bcl-2 homologous antagonist/killer;bcl-2-like protein 7;bcl2-L-7;BCL2-like 7 protein;BCL2L7;CDN1;pro-apoptotic protein BAK
Weitere Details:: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.