A23500
[KD Validated] eIF4EBP1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23500
- Zusätzliche Namen:
- [KD Validated] eIF4EBP1|4E-BP1|4EBP1|BP-1|PHAS-I
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN
- Uniprot:
- Q13541
- Synonyme:
- 4E-BP1;4EBP1;BP-1;eIF4E-binding protein 1;eukaryotic translation initiation factor 4E-binding protein 1;PHAS-I;phosphorylated heat- and acid-stable protein regulated by insulin 1
- Weitere Details:
- This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.
- Versandbedingungen:
- Blue Ice
![[KD Validated] eIF4EBP1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23500/A23500_1.jpg)
![[KD Validated] eIF4EBP1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23500/A23500_2.jpg)
![[KD Validated] eIF4EBP1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23500/A23500_ARC56864-01_KO-WB_01.jpg)
![[KD Validated] eIF4EBP1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23500/A23500_ARC56864-01_IF_01.jpg)