Tau Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23490
Zusätzliche Namen:: DDPAC|FTDP-17|MAPTL|MSTD|MTBT1|MTBT2|PPND|PPP1R103|TAU|tau-40|Tau-PHF6
Anwendung:: ELISA, WB, IHC-P, IF, IP
Molekulargewicht:: 50-80 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG
Uniprot:: P10636
Synonyme:: DDPAC;FTDP-17;G protein beta1/gamma2 subunit-interacting factor 1;MAPTL;microtubule-associated protein tau;MSTD;MTBT1;MTBT2;neurofibrillary tangle protein;paired helical filament-tau;PHF-tau;PPND;PPP1R103;protein phosphatase 1, regulatory subunit 103;TAU;tau-40
Weitere Details:: This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.