Sarm1 Mouse monoclonal antibody

Größe

Auf Anfrage

SKU:: A23440
Zusätzliche Namen:: A830091I15Rik|MyD885|Sarm|Sarm1
Anwendung:: ELISA, WB
Molekulargewicht:: 73kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Mouse
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVE
Uniprot:: Q6PDS3
Synonyme:: A830091I15Rik;C78606;hSARM1;HsTIR;MyD88-5;MyD885;NAD(+) hydrolase SARM1;NADase SARM1;NADP(+) hydrolase SARM1;SAM domain-containing protein 2;SAMD2;SARM;sterile alpha and Armadillo repeat protein;sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila;sterile alpha and TIR motif containing 1;sterile alpha and TIR motif-containing protein 1;sterile alpha motif domain-containing protein 2;tir-1 homolog
Weitere Details:: Enables NAD+ nucleosidase activity. Involved in NAD catabolic process; positive regulation of neuron death; and regulation of dendrite morphogenesis. Acts upstream of or within regulation of apoptotic process and response to glucose. Located in several cellular components, including dendrite; microtubule; and mitochondrion. Is extrinsic component of mitochondrial outer membrane. Is expressed in immune system; nervous system; neural retina; and tongue. Orthologous to human SARM1 (sterile alpha and TIR motif containing 1).

Versandbedingungen:: Blue Ice