[KO Validated] FAM38A/PIEZO1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23380
Zusätzliche Namen:: DHS|ER|FAM38A|FAM38A/PIEZO1|LMPH3|LMPHM6|Mib
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 287kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSP
Uniprot:: Q92508
Synonyme:: DHS;FAM38A;family with sequence similarity 38, member A;LMPH3;LMPHM6;membrane protein induced by beta-amyloid treatment;Mib;piezo-type mechanosensitive ion channel component 1;Protein FAM38A
Weitere Details:: The protein encoded by this gene is a mechanically-activated ion channel that links mechanical forces to biological signals. The encoded protein contains 36 transmembrane domains and functions as a homotetramer. Defects in this gene have been associated with dehydrated hereditary stomatocytosis.