ABflo[R] 488 Rabbit anti-Human CD116 monoclonal antibody

Größe

Auf Anfrage

SKU:: A23355
Zusätzliche Namen:: alphaGMR|CD116|CDw116|CSF2R|CSF2RAX|CSF2RAY|CSF2RX|CSF2RY|GM-CSF-R-alpha|GMCSFR|GMCSFR-alpha|GMR|GMR-alpha|SMDP4
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Uniprot:: P15509
Synonyme:: alpha-GM-CSF receptor;alphaGMR;CD116;CD116 antigen;CDw116;colony stimulating factor 2 receptor alpha subunit;colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage);CSF2R;CSF2RAX;CSF2RAY;CSF2RX;CSF2RY;GM-CSF receptor alpha subunit;GM-CSF-R-alpha;GMCSFR;GMCSFR-alpha;GMR;GMR-alpha;granulocyte-macrophage colony-stimulating factor receptor alpha chain;granulocyte-macrophage colony-stimulating factor receptor subunit alpha;SMDP4
Weitere Details:: The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.

Versandbedingungen:: Blue Ice