RhoGAP Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2330
Zusätzliche Namen:: GFI2|p190-B|p190BRhoGAP|RhoGAP|RhoGAP5
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 190 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSG
Uniprot:: Q13017
Synonyme:: GFI2;growth factor independent 2;p100 RasGAP-associated p105 protein;p105 RhoGAP;p190-B;p190BRhoGAP;rho GTPase-activating protein 5;rho-type GTPase-activating protein 5;RhoGAP5
Weitere Details:: Rho GTPase activating protein 5 negatively regulates RHO GTPases, a family which may mediate cytoskeleton changes by stimulating the hydrolysis of bound GTP. Two transcript variants encoding different isoforms have been found for this gene.