A23267
Nlrp6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A23267
- Zusätzliche Namen:
- Avr|Nalp6|Navr|Navr/Avr|Nlrp6|Non-AVR|Pypaf5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 101kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELLGPLGEPEPERARRSDTHTFNRLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGE
- Uniprot:
- Q91WS2
- Synonyme:
- AI504961;angiotensin II/vasopressin receptor;Avr;N;NACHT, leucine rich repeat and PYD containing 6;NACHT, LRR and PYD domains-containing protein 6;NACHT/LRR/pyrin domain-containing protein 6;Nalp6;Navr;Navr/Avr;non-angiotensin-vasopressin receptor;Non-AVR;Pypaf5;PYRIN-containing APAF1-like protein 5;PYRIN-containing APAF1-like protein 5-like
- Weitere Details:
- The protein encoded by this gene binds arginine-vasopressin and may be involved in the arginine-vasopressin-mediated regulation of renal salt-water balance. The encoded protein also mediates inflammatory responses in the colon to allow recovery from intestinal epithelial damage and protects against tumorigenesis and the development of colitis. Finally, this protein can increase activation of NF-kappa-B, activation of CASP1 through interaction with ASC, and cAMP accumulation.
- Versandbedingungen:
- Blue Ice

