BRD7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23265
Zusätzliche Namen:: BP75|BRD7|CELTIX1|NAG4|SMARCI1
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD
Uniprot:: Q9NPI1
Synonyme:: 75 kDa bromodomain protein;BP75;bromodomain-containing protein 7;CELTIX1;NAG4;protein CELTIX-1;SMARCI1
Weitere Details:: This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants.