A23264
TNFA Alpha Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23264
- Zusätzliche Namen:
- RATTNF|TNF-alpha|Tnfa|TNFA Alpha
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa/26kDa
- Spezies-Reaktivität:
- Rat
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
- Uniprot:
- P16599
- Synonyme:
- APC1 protein;cachectin;DIF;RATTNF;TNF-a;TNF-alpha;TNF, macrophage-derived;TNF, monocyte-derived;TNFA;TNFSF2;TNLG1F;tumor necrosis factor;tumor necrosis factor (TNF superfamily, member 2);tumor necrosis factor ligand 1F;tumor necrosis factor ligand superfamily member 2;tumor necrosis factor-alpha
- Weitere Details:
- Enables tumor necrosis factor receptor binding activity. Involved in several processes, including positive regulation of cell communication; positive regulation of macromolecule metabolic process; and positive regulation of neuron death. Located in several cellular components, including external side of plasma membrane; extracellular space; and neuronal cell body. Used to study several diseases, including cerebrovascular disease (multiple); liver disease (multiple); peptic esophagitis; perinatal necrotizing enterocolitis; and periventricular leukomalacia. Biomarker of several diseases, including brain disease (multiple); congestive heart failure (multiple); inflammatory bowel disease (multiple); lung disease (multiple); and non-alcoholic fatty liver disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); lung disease (multiple); and skin disease (multiple). Orthologous to human TNF (tumor necrosis factor).
- Versandbedingungen:
- Blue Ice