CD107b Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23260
Zusätzliche Namen:: CD107b|Lamp II|Lamp-2|Lamp-2a|Lamp-2b|Lamp-2c|LGP-B|Mac3
Anwendung:: ELISA, WB
Molekulargewicht:: 102kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ
Uniprot:: P17047
Synonyme:: CD107 antigen-like family member B;CD107b;DND;Lam;Lamp;Lamp II;LAMP-2;Lamp-2a;Lamp-2b;Lamp-2c;LAMPB;LGP-96;LGP-B;LGP110;lysosomal membrane glycoprotein 2;lysosomal membrane glycoprotein type B;lysosome-associated membrane glycoprotein 2;Mac;Mac3
Weitere Details:: Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation; protein stabilization; and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane; lysosomal membrane; and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system; egg cylinder; lung; and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2).

Versandbedingungen:: Blue Ice