A23257
PDE4B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A23257
- Zusätzliche Namen:
- DPDE4|PDE4B|PDEIVB
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 90kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT
- Uniprot:
- Q07343
- Synonyme:
- cAMP-specific 3',5'-cyclic phosphodiesterase 4B;DPDE4;dunce-like phosphodiesterase E4;PDE32;PDEIVB;phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
- Weitere Details:
- This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice

