CYP27A1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23250
Zusätzliche Namen:: CP27|CTX|CYP27|CYP27A1
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ
Uniprot:: Q02318
Synonyme:: 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase;5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase;5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase;cholestanetriol 26-monooxygenase;CP27;CTX;CYP27;cytochrome P-450C27/25;cytochrome P450 27;cytochrome P450, family 27, subfamily A, polypeptide 1;cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1;sterol 26-hydroxylase, mitochondrial;sterol 27-hydroxylase;vitamin D(3) 25-hydroxylase
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.

Versandbedingungen:: Blue Ice