SIAH1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23247
Zusätzliche Namen:: BURHAS|SIAH1|SIAH1A
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 31 kDa/35 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKY
Uniprot:: Q8IUQ4
Synonyme:: BURHAS;E3 ubiquitin-protein ligase SIAH1;RING-type E3 ubiquitin transferase SIAH1;seven in absentia homolog 1;siah-1a;SIAH1A
Weitere Details:: This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.