IL17A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23226
Zusätzliche Namen:: Ctla-8|Ctla8|IL-17|IL-17A|Il17|IL17A
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa (Recombinant Protein)
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Uniprot:: Q62386
Synonyme:: Ctl;Ctla;Ctla-8;Ctla8;cytotoxic T-lymphocyte-associated antigen 8;Il;IL-;IL-17;IL-17A;Il17;interleukin-17A
Weitere Details:: This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.