ITPR3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23202
Zusätzliche Namen:: CMT1J|IP3R|IP3R3|ITPR3
Anwendung:: ELISA, WB
Molekulargewicht:: 300kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM
Uniprot:: Q14573
Synonyme:: inositol 1,4,5-triphosphate receptor, type 3;inositol 1,4,5-trisphosphate receptor type 3;insP3R3;IP3 receptor;IP3 receptor isoform 3;IP3R;IP3R3;Type 3 inositol 1,4,5-trisphosphate receptor;type 3 InsP3 receptor
Weitere Details:: This gene encodes a receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1,4,5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth.