A23202
ITPR3 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A23202
- Zusätzliche Namen:
- CMT1J|IP3R|IP3R3|ITPR3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 300kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM
- Uniprot:
- Q14573
- Synonyme:
- inositol 1,4,5-triphosphate receptor, type 3;inositol 1,4,5-trisphosphate receptor type 3;insP3R3;IP3 receptor;IP3 receptor isoform 3;IP3R;IP3R3;Type 3 inositol 1,4,5-trisphosphate receptor;type 3 InsP3 receptor
- Weitere Details:
- This gene encodes a receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1,4,5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth.
- Versandbedingungen:
- Blue Ice

