[KD Validated] BUB1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23198
Zusätzliche Namen:: [KD Validated] BUB1|BUB1A|BUB1L|hBUB1|MCPH30
Anwendung:: ELISA, WB
Molekulargewicht:: 130 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Uniprot:: O43683
Synonyme:: BUB1 budding uninhibited by benzimidazoles 1 homolog;BUB1A;BUB1L;budding uninhibited by benzimidazoles 1 homolog;hBUB1;mitotic checkpoint serine/threonine-protein kinase BUB1;mitotic spindle checkpoint kinase;putative serine/threonine-protein kinase
Weitere Details:: This gene encodes a serine/threonine-protein kinase that play a central role in mitosis. The encoded protein functions in part by phosphorylating members of the mitotic checkpoint complex and activating the spindle checkpoint. This protein also plays a role in inhibiting the activation of the anaphase promoting complex/cyclosome. This protein may also function in the DNA damage response. Mutations in this gene have been associated with aneuploidy and several forms of cancer. Alternate splicing results in multiple transcript variants.